McDonnell Genome Institute

Washington University

Transcript

lnc-PRLH-1:3

Chromosome

chr2

Gene Name

lnc-PRLH-1

Start

237591168

CPC Label

noncoding

End

237595981

Cancer

OSCC

Strand

+

Peptide

GGSSLESQHFGRR

Modified Peptide

n[145]GGSSLESQHFGRR

Peptide Length

13

ORF Length

42

Open Reading Frame (ORF)

LGERRMGGRYKYQFYSKNAKRGQRGGSSLESQHFGRRAGRIT

Conservation Score

0.037

PhyloCSF Frame 1

0

No. of Spectra

30

CPC Coding Probability

0.0230524

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9726

PhyloCSF Frame 3

0

CNTI Score

-0.285002984