McDonnell Genome Institute

Washington University

Transcript

lnc-PRL-7:5

Chromosome

chr6

Gene Name

lnc-PRL-7

Start

22859045

CPC Label

noncoding

End

23177038

Cancer

OV

Strand

-

Peptide

MLLQNEVLR

Modified Peptide

n[145]MLLQNEVLR

Peptide Length

9

ORF Length

74

Open Reading Frame (ORF)

LTQEMCIKLTGSQKMLLQNEVLRSSSLSDLLQTSCLWTFISTHLLLPTTARLAMRTRLPLPQGELTAGEMGSGD

Conservation Score

0.999

PhyloCSF Frame 1

0

No. of Spectra

20

CPC Coding Probability

0.0443178

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9923

PhyloCSF Frame 3

0

CNTI Score

-0.459788239