McDonnell Genome Institute

Washington University

Transcript

lnc-PRL-3:2

Chromosome

chr6

Gene Name

lnc-PRL-3

Start

22588560

CPC Label

noncoding

End

22717924

Cancer

OSCC

Strand

-

Peptide

YMILHLIK

Modified Peptide

n[145]YM[147]ILHLIK

Peptide Length

8

ORF Length

95

Open Reading Frame (ORF)

LAGRRVPLKIEEEAIRVQRSSYVRLRHFLFIGDYKTFALSSLGADTILVLRPPAPRRSLKQHVASTASCCLLARSRGSNQYKNLRYMILHLIKIV

Conservation Score

0.364

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.037122

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9099

PhyloCSF Frame 3

0

CNTI Score

0.649444214