McDonnell Genome Institute

Washington University

Transcript

lnc-PRKX-2:1

Chromosome

chrX

Gene Name

lnc-PRKX-2

Start

3900696

CPC Label

noncoding

End

3903316

Cancer

OSCC

Strand

-

Peptide

LCPTLTMDAGSVRPSGADSPACAQDLSAFPSR

Modified Peptide

n[145]LCPTLTM[147]DAGSVRPSGADSPACAQDLSAFPSR

Peptide Length

32

ORF Length

84

Open Reading Frame (ORF)

LCPTLTMDAGSVRPSGADSPACAQDLSAFPSRRVLRAHRALCGPDPKACLFLGLLLPALRHTEHTVGAHWGVKETPTTEWLLRG

Conservation Score

0.997

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0983144

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7804

PhyloCSF Frame 3

0

CNTI Score

-0.354206879