McDonnell Genome Institute

Washington University

Transcript

lnc-PRKN-10:2

Chromosome

chr6

Gene Name

lnc-PRKN-10

Start

163258331

CPC Label

noncoding

End

163267023

Cancer

OV

Strand

-

Peptide

STDVEPPASR

Modified Peptide

n[145]STDVEPPASR

Peptide Length

10

ORF Length

41

Open Reading Frame (ORF)

LHFAKSTDVEPPASRADQQGRVSCECLAQHSISTESRSSWV

Conservation Score

0.148

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0597868

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.2212

PhyloCSF Frame 3

0

CNTI Score

-0.339798666