McDonnell Genome Institute

Washington University

Transcript

lnc-PRKD1-17:1

Chromosome

chr14

Gene Name

lnc-PRKD1-17

Start

28673240

CPC Label

noncoding

End

28673727

Cancer

CCRC

Strand

-

Peptide

APLATGEDDSDEVSHLVENFDEASK

Modified Peptide

n[230]APLATGEDDSDEVSHLVENFDEASK

Peptide Length

25

ORF Length

42

Open Reading Frame (ORF)

LPEDLSKQPVGGKAPLATGEDDSDEVSHLVENFDEASKNESN

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.0491961

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9997

PhyloCSF Frame 3

0

CNTI Score

-0.399170029