McDonnell Genome Institute

Washington University

Transcript

lnc-PRKD1-1:7

Chromosome

chr14

Gene Name

lnc-PRKD1-1

Start

30283506

CPC Label

noncoding

End

30297039

Cancer

CCRC

Strand

-

Peptide

LHPQVLISLYLPVPGVR

Modified Peptide

‚Äč

Peptide Length

17

ORF Length

39

Open Reading Frame (ORF)

LMLTDTTKLHPQVLISLYLPVPGVRQHACGLKRPLVLTS

Conservation Score

1

PhyloCSF Frame 1

-4.816

No. of Spectra

29

CPC Coding Probability

0.0326543

PhyloCSF Frame 2 

-1.387

CNTI Index

noncoding

Max Probability

0.9963

PhyloCSF Frame 3

-4.675

CNTI Score

-0.371048243