McDonnell Genome Institute

Washington University

Transcript

lnc-PRKD1-1:6

Chromosome

chr14

Gene Name

lnc-PRKD1-1

Start

30215442

CPC Label

noncoding

End

30297039

Cancer

OV

Strand

-

Peptide

GTGTGVELEAR

Modified Peptide

n[145]GTGTGVELEAR

Peptide Length

11

ORF Length

38

Open Reading Frame (ORF)

LKDYPNFFVRGTGTGVELEARRAALEVSLQPRHKAMRI

Conservation Score

0.333

PhyloCSF Frame 1

-5.837

No. of Spectra

5

CPC Coding Probability

0.0296823

PhyloCSF Frame 2 

-3.71

CNTI Index

noncoding

Max Probability

0.9625

PhyloCSF Frame 3

-5.806

CNTI Score

-0.327388345