McDonnell Genome Institute

Washington University

Transcript

lnc-PRKCQ-6:1

Chromosome

chr10

Gene Name

lnc-PRKCQ-6

Start

6814325

CPC Label

noncoding

End

6819204

Cancer

CCRC

Strand

-

Peptide

QGSTFSGR

Modified Peptide

n[230]QGSTFSGR

Peptide Length

8

ORF Length

72

Open Reading Frame (ORF)

LLNSSSTSEGSRADIATHAFLTPGSKLLATMLKQGSTFSGRQPIFILWSLSPRLSFHVPPSNLVKSSASLIG

Conservation Score

0.179

PhyloCSF Frame 1

-4.985

No. of Spectra

3

CPC Coding Probability

0.133173

PhyloCSF Frame 2 

-4.5

CNTI Index

noncoding

Max Probability

0.9925

PhyloCSF Frame 3

-4.949

CNTI Score

-0.425126277