McDonnell Genome Institute

Washington University

Transcript

lnc-PRKCQ-3:1

Chromosome

chr10

Gene Name

lnc-PRKCQ-3

Start

6583678

CPC Label

noncoding

End

6585358

Cancer

OV

Strand

-

Peptide

ISSFLSSQEGR

Modified Peptide

n[145]ISSFLSSQEGR

Peptide Length

11

ORF Length

37

Open Reading Frame (ORF)

LWEDGLWQLREQTHRISSFLSSQEGRWIQGRGQVFPR

Conservation Score

0.644

PhyloCSF Frame 1

-4.338

No. of Spectra

2

CPC Coding Probability

0.00903861

PhyloCSF Frame 2 

-5.447

CNTI Index

noncoding

Max Probability

0.9991

PhyloCSF Frame 3

-4.435

CNTI Score

-0.42544397