McDonnell Genome Institute

Washington University

Transcript

lnc-PRKCQ-2:5

Chromosome

chr10

Gene Name

lnc-PRKCQ-2

Start

6774215

CPC Label

noncoding

End

6779180

Cancer

OSCC

Strand

-

Peptide

LMHDAYGAK

Modified Peptide

n[145]LMHDAYGAK

Peptide Length

9

ORF Length

57

Open Reading Frame (ORF)

LMHDAYGAKCWECKPDVYFKSIGVLEDSPCLQCKHHEERDVLDLFIAIFPGSDPGTE

Conservation Score

0.049

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.0462668

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8073

PhyloCSF Frame 3

0

CNTI Score

-0.342783069