McDonnell Genome Institute

Washington University

Transcript

lnc-PRKCQ-2:2

Chromosome

chr10

Gene Name

lnc-PRKCQ-2

Start

6738434

CPC Label

noncoding

End

6842906

Cancer

OV

Strand

-

Peptide

LLCYDTAGKPWPEASAMPLK

Modified Peptide

n[145]LLCYDTAGKPWPEASAMPLK

Peptide Length

20

ORF Length

35

Open Reading Frame (ORF)

LLCYDTAGKPWPEASAMPLKFPTCRTMSSIDLISF

Conservation Score

0.161

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.031295

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5125

PhyloCSF Frame 3

0

CNTI Score

-0.342783069