McDonnell Genome Institute

Washington University

Transcript

lnc-PRKCH-1:1

Chromosome

chr14

Gene Name

lnc-PRKCH-1

Start

61187075

CPC Label

noncoding

End

61203935

Cancer

OV

Strand

+

Peptide

LPAPGSCCLWDLLTPR

Modified Peptide

n[145]LPAPGSCCLWDLLTPR

Peptide Length

16

ORF Length

58

Open Reading Frame (ORF)

LSGSQAAARAGGLVAPQPNLFPSGRLPAPGSCCLWDLLTPRRSSSASRATSSPPMITH

Conservation Score

0.104

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.119744

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4421

PhyloCSF Frame 3

0

CNTI Score

-0.338425988