McDonnell Genome Institute

Washington University

Transcript

lnc-PRKAR2A-3:1

Chromosome

chr3

Gene Name

lnc-PRKAR2A-3

Start

48723307

CPC Label

noncoding

End

48724236

Cancer

OV

Strand

-

Peptide

QAANLLLPTPDSQTYK

Modified Peptide

n[145]QAANLLLPTPDSQTYK

Peptide Length

16

ORF Length

129

Open Reading Frame (ORF)

LFSPSLVPDTSPLGDYLPVLKQARQEIRQAANLLLPTPDSQTYKDTLAGRSVLIKNLTPQTLQPRWTGPYLVIYSTPTAIRLQDPPHWVHHSRIKLCLSASQPDLSSSSWKSEVLSPTSLKLTRISEKQ

Conservation Score

0.564

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0222121

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9763

PhyloCSF Frame 3

0

CNTI Score

-0.362733038