McDonnell Genome Institute

Washington University

Transcript

lnc-PRKAG2-1:1

Chromosome

chr7

Gene Name

lnc-PRKAG2-1

Start

151835715

CPC Label

noncoding

End

151879212

Cancer

CCRC

Strand

-

Peptide

LSIQWDNTVLLGLLK

Modified Peptide

n[230]LSIQWDNTVLLGLLK

Peptide Length

15

ORF Length

40

Open Reading Frame (ORF)

LSIQWDNTVLLGLLKSSSKKPARRRPRSPTPVGPGWLLGC

Conservation Score

0.096

PhyloCSF Frame 1

-4.518

No. of Spectra

1

CPC Coding Probability

0.0114537

PhyloCSF Frame 2 

-5.277

CNTI Index

noncoding

Max Probability

0.9997

PhyloCSF Frame 3

-3.52

CNTI Score

-0.446078256