McDonnell Genome Institute

Washington University

Transcript

lnc-PRKACG-6:1

Chromosome

chr9

Gene Name

lnc-PRKACG-6

Start

68788306

CPC Label

noncoding

End

68789670

Cancer

BRCA-Luminal B

Strand

-

Peptide

LEIFSWR

Modified Peptide

n[145]LEIFSWR

Peptide Length

7

ORF Length

46

Open Reading Frame (ORF)

LEIFSWRNTGEVWYTVLFVNTFLRCKNKLLRQKVCLQLSLPLTTVS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

8

CPC Coding Probability

0.396176

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9983

PhyloCSF Frame 3

0

CNTI Score

-0.346950095