McDonnell Genome Institute

Washington University

Transcript

lnc-PRKACG-1:1

Chromosome

chr9

Gene Name

lnc-PRKACG-1

Start

68953087

CPC Label

noncoding

End

68975841

Cancer

OV

Strand

-

Peptide

WGLSMGHVGIGK

Modified Peptide

n[145]WGLSMGHVGIGK

Peptide Length

12

ORF Length

35

Open Reading Frame (ORF)

MWGLSMGHVGIGKSSFPDLLSHDEIPIKAKIQRTL

Conservation Score

0.035

PhyloCSF Frame 1

-5.677

No. of Spectra

3

CPC Coding Probability

0.0712321

PhyloCSF Frame 2 

-4.749

CNTI Index

noncoding

Max Probability

0.9038

PhyloCSF Frame 3

-5.59

CNTI Score

-0.38313229