McDonnell Genome Institute

Washington University

Transcript

lnc-PRKACB-11:1

Chromosome

chr1

Gene Name

lnc-PRKACB-11

Start

81721692

CPC Label

noncoding

End

81723068

Cancer

CCRC

Strand

+

Peptide

AIDLFTNAIK

Modified Peptide

AIDLFTNAIK

Peptide Length

10

ORF Length

47

Open Reading Frame (ORF)

LQKAIDLFTNAIKLNLRLAVLYAKRASVFVKLQKPNAAIQDCDRAMK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0539222

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8609

PhyloCSF Frame 3

0

CNTI Score

-0.32951513