McDonnell Genome Institute

Washington University

Transcript

lnc-PRIMPOL-7:9

Chromosome

chr4

Gene Name

lnc-PRIMPOL-7

Start

184474834

CPC Label

noncoding

End

184482393

Cancer

OV

Strand

+

Peptide

ITGTTSVLATGAPLQGAAIQEVRK

Modified Peptide

n[145]ITGTTSVLATGAPLQGAAIQEVRK

Peptide Length

24

ORF Length

61

Open Reading Frame (ORF)

MLSFLPRITGTTSVLATGAPLQGAAIQEVRKSWKTRVPPLPEQLPIQKPQINSPELQRTLL

Conservation Score

0.737

PhyloCSF Frame 1

-5.564

No. of Spectra

4

CPC Coding Probability

0.210299

PhyloCSF Frame 2 

-4.328

CNTI Index

noncoding

Max Probability

0.9474

PhyloCSF Frame 3

-4.295

CNTI Score

-0.353361666