McDonnell Genome Institute

Washington University

Transcript

lnc-PRIMPOL-7:6

Chromosome

chr4

Gene Name

lnc-PRIMPOL-7

Start

184474807

CPC Label

noncoding

End

184484662

Cancer

OV

Strand

+

Peptide

MEAGSLRTRHLQSWFLLK

Modified Peptide

n[145]M[147]EAGSLRTRHLQSWFLLK

Peptide Length

18

ORF Length

76

Open Reading Frame (ORF)

MEAGSLRTRHLQSWFLLKAVGETSTPPGFWWFASMLGHSLACKCITPISVLMVMWCSPCTCVCVHISFFFFFFFFF

Conservation Score

0.389

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.210299

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9892

PhyloCSF Frame 3

0

CNTI Score

-0.338487405