McDonnell Genome Institute

Washington University

Transcript

lnc-PRIMPOL-2:2

Chromosome

chr4

Gene Name

lnc-PRIMPOL-2

Start

184506127

CPC Label

noncoding

End

184515654

Cancer

OV

Strand

+

Peptide

GVHVSYLEK

Modified Peptide

n[145]GVHVSYLEK

Peptide Length

9

ORF Length

34

Open Reading Frame (ORF)

LIYMVSPTYQPKAMPSDLFGCRTKGVHVSYLEKT

Conservation Score

0.917

PhyloCSF Frame 1

-5.532

No. of Spectra

11

CPC Coding Probability

0.446803

PhyloCSF Frame 2 

-5.161

CNTI Index

noncoding

Max Probability

0.9506

PhyloCSF Frame 3

-6.575

CNTI Score

-0.34686579