McDonnell Genome Institute

Washington University

Transcript

lnc-PRIM2-7:8

Chromosome

chr6

Gene Name

lnc-PRIM2-7

Start

57961656

CPC Label

noncoding

End

58096507

Cancer

EOGC

Strand

+

Peptide

SLAGIRPIIQR

Modified Peptide

n[145]SLAGIRPIIQR

Peptide Length

11

ORF Length

45

Open Reading Frame (ORF)

LAGGQRSLAGIRPIIQRTENQEALMSKRRRRWISLLMLLLPFIPI

Conservation Score

0.203

PhyloCSF Frame 1

0

No. of Spectra

17

CPC Coding Probability

0.0638949

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9996

PhyloCSF Frame 3

0

CNTI Score

-0.367575146