McDonnell Genome Institute

Washington University

Transcript

lnc-PRICKLE2-3:3

Chromosome

chr3

Gene Name

lnc-PRICKLE2-3

Start

64453117

CPC Label

noncoding

End

64494269

Cancer

BRCA-Luminal B

Strand

-

Peptide

LTPCALR

Modified Peptide

n[145]LTPCALR

Peptide Length

7

ORF Length

111

Open Reading Frame (ORF)

LLGILSECWKSRFVGARVCPAHEGEGVGYGQRWQGRLCETLHSASSTAGHFSGPGASCSQNGHDASGGRLTPCALRSSSELRGRPLLMQFCLLCMQWIAAISNQPQWEATC

Conservation Score

0.13

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.0615059

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9984

PhyloCSF Frame 3

0

CNTI Score

-0.307909539