McDonnell Genome Institute

Washington University

Transcript

lnc-PRICKLE2-1:1

Chromosome

chr3

Gene Name

lnc-PRICKLE2-1

Start

64444481

CPC Label

noncoding

End

64445476

Cancer

LUAD

Strand

-

Peptide

GQPCNACGDQCPGFALHK

Modified Peptide

n[230]GQPCNACGDQCPGFALHK

Peptide Length

18

ORF Length

79

Open Reading Frame (ORF)

MFSRSSRKRLSSRSVSVPRSSGADRRAPPAGRERPRAAPLRPAAAHLWPQLTGLGRIERGQPCNACGDQCPGFALHKWR

Conservation Score

1

PhyloCSF Frame 1

10.185

No. of Spectra

7

CPC Coding Probability

0.110633

PhyloCSF Frame 2 

-3.05

CNTI Index

noncoding

Max Probability

0.9998

PhyloCSF Frame 3

0.234

CNTI Score

-0.30044773