McDonnell Genome Institute

Washington University

Transcript

lnc-PRICKLE1-3:1

Chromosome

chr12

Gene Name

lnc-PRICKLE1-3

Start

42636814

CPC Label

noncoding

End

42637111

Cancer

OV

Strand

-

Peptide

HNEETGVNVGPLIIK

Modified Peptide

n[145]HNEETGVNVGPLIIK

Peptide Length

15

ORF Length

37

Open Reading Frame (ORF)

LPFLEVQKFPFCDGSHTKHNEETGVNVGPLIIKKKET

Conservation Score

1

PhyloCSF Frame 1

-4.505

No. of Spectra

2

CPC Coding Probability

0.135033

PhyloCSF Frame 2 

-5.141

CNTI Index

noncoding

Max Probability

0.9941

PhyloCSF Frame 3

-4.682

CNTI Score

-0.373228306