McDonnell Genome Institute

Washington University

Transcript

lnc-PRH2-3:1

Chromosome

chr12

Gene Name

lnc-PRH2-3

Start

10770304

CPC Label

noncoding

End

10770605

Cancer

EOGC

Strand

+

Peptide

GAIMLLEKSQGKVLAATVVAVGSGSK

Modified Peptide

n[145]GAIM[147]LLEKSQGKVLAATVVAVGSGSK

Peptide Length

26

ORF Length

69

Open Reading Frame (ORF)

LVERCAAKTVTKGAIMLLEKSQGKVLAATVVAVGSGSKGKGGEIQPVRVNVRDNVLLPEYGGTKVDDKD

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0447845

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1766

PhyloCSF Frame 3

0

CNTI Score

-0.37564903