McDonnell Genome Institute

Washington University

Transcript

lnc-PREX1-9:1

Chromosome

chr20

Gene Name

lnc-PREX1-9

Start

48461871

CPC Label

noncoding

End

48465180

Cancer

OSCC

Strand

-

Peptide

TALGGWAR

Modified Peptide

n[145]TALGGWAR

Peptide Length

8

ORF Length

58

Open Reading Frame (ORF)

LFKTALGGWARWLMPVIPVLWEAEDHLRLGVQDQPGQRGKTPSLLKIQKLVGHGGGHL

Conservation Score

0.098

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0184245

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9959

PhyloCSF Frame 3

0

CNTI Score

-0.421442201