McDonnell Genome Institute

Washington University

Transcript

lnc-PREX1-6:2

Chromosome

chr20

Gene Name

lnc-PREX1-6

Start

48358685

CPC Label

noncoding

End

48359697

Cancer

OSCC

Strand

-

Peptide

ILGGRAGGTGVPPR

Modified Peptide

n[145]ILGGRAGGTGVPPR

Peptide Length

14

ORF Length

60

Open Reading Frame (ORF)

LGSSFHPGDRRILGGRAGGTGVPPRRSAPGGRHTESLPRWKCLQGRKRHFLSSAIRSTEG

Conservation Score

0.046

PhyloCSF Frame 1

-3.344

No. of Spectra

6

CPC Coding Probability

0.065982

PhyloCSF Frame 2 

-4.458

CNTI Index

noncoding

Max Probability

0.5843

PhyloCSF Frame 3

-3.808

CNTI Score

-0.324111277