McDonnell Genome Institute

Washington University

Transcript

lnc-PREX1-3:1

Chromosome

chr20

Gene Name

lnc-PREX1-3

Start

48471962

CPC Label

noncoding

End

48478836

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

FAELETLGGASAAVQV

Modified Peptide

n[145]FAELETLGGASAAVQV

Peptide Length

16

ORF Length

40

Open Reading Frame (ORF)

LQFKFEVRGAGDPGRSRCCSSSLRFAELETLGGASAAVQV

Conservation Score

0.014

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0979868

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9984

PhyloCSF Frame 3

0

CNTI Score

-0.281387182