McDonnell Genome Institute

Washington University

Transcript

lnc-PREX1-1:2

Chromosome

chr20

Gene Name

lnc-PREX1-1

Start

48821687

CPC Label

noncoding

End

48849458

Cancer

OV

Strand

-

Peptide

MGLVSLAFETSGHPFLGEK

Modified Peptide

n[145]MGLVSLAFETSGHPFLGEK

Peptide Length

19

ORF Length

45

Open Reading Frame (ORF)

MGLVSLAFETSGHPFLGEKDTPLSGQRAEDLLGLGPLPLIKKPTS

Conservation Score

1

PhyloCSF Frame 1

-2.909

No. of Spectra

2

CPC Coding Probability

0.0190704

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8985

PhyloCSF Frame 3

0

CNTI Score

-0.414799013