McDonnell Genome Institute

Washington University

Transcript

lnc-PRDX6-4:1

Chromosome

chr1

Gene Name

lnc-PRDX6-4

Start

173351688

CPC Label

noncoding

End

173352004

Cancer

EOGC

Strand

+

Peptide

DNEVQVVR

Modified Peptide

n[145]DNEVQVVR

Peptide Length

8

ORF Length

100

Open Reading Frame (ORF)

MPNRKDNEVQVVRVRGHYKGQQIGTVVQVYRKKYVIYIEWVQQEKANGTTVHVGIHPSKAVITRLKLDKDRKKIPEQKAKSHQAGKEKGKYKEEKIEEMQ

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

12

CPC Coding Probability

0.133989

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.2753

PhyloCSF Frame 3

0

CNTI Score

0.689099824