McDonnell Genome Institute

Washington University

Transcript

lnc-PRDX3-6:2

Chromosome

chr10

Gene Name

lnc-PRDX3-6

Start

119203929

CPC Label

noncoding

End

119207447

Cancer

HCC

Strand

-

Peptide

MVTQQVSVR

Modified Peptide

n[230]MVTQQVSVR

Peptide Length

9

ORF Length

35

Open Reading Frame (ORF)

MVTQQVSVRLFFCPLQAVASCLHKYMVVHQVFVPL

Conservation Score

1

PhyloCSF Frame 1

-5.02

No. of Spectra

9

CPC Coding Probability

0.0908282

PhyloCSF Frame 2 

-6.266

CNTI Index

coding

Max Probability

0.9987

PhyloCSF Frame 3

-6.21

CNTI Score

0.738232988