McDonnell Genome Institute

Washington University

Transcript

lnc-PRDM9-8:2

Chromosome

chr5

Gene Name

lnc-PRDM9-8

Start

23980586

CPC Label

noncoding

End

23980938

Cancer

HCC

Strand

+

Peptide

LKVSDTVIPLYIPQCGECK

Modified Peptide

LKVSDTVIPLYIPQCGECK

Peptide Length

19

ORF Length

50

Open Reading Frame (ORF)

MKLLGIVESVGEEVTKLKVSDTVIPLYIPQCGECKFGLNPKTNLCQKIRV

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

14

CPC Coding Probability

0.0418302

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.999

PhyloCSF Frame 3

0

CNTI Score

-0.335453538