McDonnell Genome Institute

Washington University

Transcript

lnc-PRDM9-4:6

Chromosome

chr5

Gene Name

lnc-PRDM9-4

Start

25083297

CPC Label

noncoding

End

25162706

Cancer

LUAD

Strand

+

Peptide

LSHTSERR

Modified Peptide

Peptide Length

8

ORF Length

49

Open Reading Frame (ORF)

LSHTSERRYQLGFLGRVGAQKAVKLTHFLHQDLLQSWMNNIEDICLKYS

Conservation Score

0.25

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.192959

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.995

PhyloCSF Frame 3

0

CNTI Score

-0.323196057