McDonnell Genome Institute

Washington University

Transcript

lnc-PRDM9-23:1

Chromosome

chr5

Gene Name

lnc-PRDM9-23

Start

21107430

CPC Label

noncoding

End

21154676

Cancer

OV

Strand

+

Peptide

MLIPSPLQDLK

Modified Peptide

n[145]MLIPSPLQDLK

Peptide Length

11

ORF Length

56

Open Reading Frame (ORF)

MLIPSPLQDLKFLPLNHAGHFVTVSGQHIYCVVVNQDDVLLRQLSVLKRNTSLLLA

Conservation Score

0.095

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.0359433

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9922

PhyloCSF Frame 3

0

CNTI Score

-0.409149306