McDonnell Genome Institute

Washington University

Transcript

lnc-PRDM9-18:3

Chromosome

chr5

Gene Name

lnc-PRDM9-18

Start

24292017

CPC Label

noncoding

End

24322016

Cancer

OV

Strand

+

Peptide

FLQNMFVQGNK

Modified Peptide

n[145]FLQNM[147]FVQGNK

Peptide Length

11

ORF Length

53

Open Reading Frame (ORF)

MVYQKPQHICKFLQNMFVQGNKLGHQAFKGSFHLGVVEPMKLRITLASCWNLK

Conservation Score

0.006

PhyloCSF Frame 1

-5.509

No. of Spectra

18

CPC Coding Probability

0.0290235

PhyloCSF Frame 2 

-6.962

CNTI Index

noncoding

Max Probability

0.994

PhyloCSF Frame 3

-5.166

CNTI Score

-0.424537807