McDonnell Genome Institute

Washington University

Transcript

lnc-PRDM9-17:1

Chromosome

chr5

Gene Name

lnc-PRDM9-17

Start

21459479

CPC Label

noncoding

End

21474456

Cancer

LUAD

Strand

+

Peptide

VTEESCQAEESFNR

Modified Peptide

VTEESCQAEESFNR

Peptide Length

14

ORF Length

33

Open Reading Frame (ORF)

LGACDHLKVTEESCQAEESFNRHLVRMGSIHSL

Conservation Score

0.986

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.191896

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.934

PhyloCSF Frame 3

0

CNTI Score

-0.329022805