McDonnell Genome Institute

Washington University

Transcript

lnc-PRDM9-162:1

Chromosome

chr5

Gene Name

lnc-PRDM9-162

Start

23951347

CPC Label

coding

End

24178263

Cancer

OSCC

Strand

+

Peptide

LHDLDTLPIANK

Modified Peptide

n[145]LHDLDTLPIANK

Peptide Length

12

ORF Length

33

Open Reading Frame (ORF)

LHDLDTLPIANKTTVELKLKMNSQRKPQNYANT

Conservation Score

0.75

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.934984

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6006

PhyloCSF Frame 3

0

CNTI Score

-0.271869739