McDonnell Genome Institute

Washington University

Transcript

lnc-PRDM9-16:1

Chromosome

chr5

Gene Name

lnc-PRDM9-16

Start

21882921

CPC Label

noncoding

End

21884029

Cancer

BRCA-Luminal A

Strand

+

Peptide

FGGTSDVEVNEK

Modified Peptide

n[145]FGGTSDVEVNEK

Peptide Length

12

ORF Length

235

Open Reading Frame (ORF)

LLSEKKISSVQSIVPALEIANAHHKPLVIIAEDVDGEALSTLILNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGKVGEVIVTKDDAMLLKGKGDKAQLEKRIQEIIGQLDVTTSEYEKEKLNEWLAKLSDGVVVLKFGGTSDVEVNEKKDRVTDALNATRAAVEGGIVLGGGFALLRCIPALDSLTPANEDQKIGMEIIKRTLKIPAMTT

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.150233

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.7391

PhyloCSF Frame 3

0

CNTI Score

0.765850349