McDonnell Genome Institute

Washington University

Transcript

lnc-PRDM8-6:1

Chromosome

chr4

Gene Name

lnc-PRDM8-6

Start

80046494

CPC Label

coding

End

80082269

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

LTPSIVCHSPGGLPR

Modified Peptide

n[145]LTPSIVCHSPGGLPR

Peptide Length

15

ORF Length

39

Open Reading Frame (ORF)

LTPSIVCHSPGGLPRWQPSAACQSLRERRKGFDMEGKGM

Conservation Score

0.056

PhyloCSF Frame 1

0

No. of Spectra

150

CPC Coding Probability

0.977416

PhyloCSF Frame 2 

-3.418

CNTI Index

coding

Max Probability

1

PhyloCSF Frame 3

-4.634

CNTI Score

0.654913462