McDonnell Genome Institute

Washington University

Transcript

lnc-PRDM7-1:2

Chromosome

chr16

Gene Name

lnc-PRDM7-1

Start

90101205

CPC Label

coding

End

90106142

Cancer

CCRC

Strand

-

Peptide

LHFQLSPGR

Modified Peptide

‚Äč

Peptide Length

9

ORF Length

49

Open Reading Frame (ORF)

MVLPVHRSLWLLYRKQEVATSATRLHFQLSPGRAAPCLAPLQILRGVLN

Conservation Score

0.875

PhyloCSF Frame 1

0

No. of Spectra

31

CPC Coding Probability

0.551279

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.996

PhyloCSF Frame 3

0

CNTI Score

-0.320096261