McDonnell Genome Institute

Washington University

Transcript

lnc-PRDM4-8:1

Chromosome

chr12

Gene Name

lnc-PRDM4-8

Start

107684822

CPC Label

noncoding

End

107685708

Cancer

OV

Strand

-

Peptide

KVAAMGK

Modified Peptide

n[145]KVAAMGK

Peptide Length

7

ORF Length

57

Open Reading Frame (ORF)

LDVCRMENLKLASQKNLGFDLLAVWPCPGHLPSMHLPLREASKRNRKVAAMGKQWQG

Conservation Score

0.837

PhyloCSF Frame 1

-3.776

No. of Spectra

17

CPC Coding Probability

0.0335577

PhyloCSF Frame 2 

-5.355

CNTI Index

noncoding

Max Probability

0.9503

PhyloCSF Frame 3

-4.623

CNTI Score

-0.357681529