McDonnell Genome Institute

Washington University

Transcript

lnc-PRDM4-6:4

Chromosome

chr12

Gene Name

lnc-PRDM4-6

Start

107882463

CPC Label

noncoding

End

107887964

Cancer

EOGC

Strand

-

Peptide

MEIQEMK

Modified Peptide

n[145]MEIQEMK

Peptide Length

7

ORF Length

38

Open Reading Frame (ORF)

MEIQEMKMRWLSLLKYNSIKGFPVVLDHSVVGELRMGE

Conservation Score

0.119

PhyloCSF Frame 1

0

No. of Spectra

11

CPC Coding Probability

0.0240368

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9996

PhyloCSF Frame 3

0

CNTI Score

-0.405964794