McDonnell Genome Institute

Washington University

Transcript

lnc-PRDM4-6:1

Chromosome

chr12

Gene Name

lnc-PRDM4-6

Start

107902506

CPC Label

noncoding

End

107903801

Cancer

EOGC

Strand

-

Peptide

QVYASLPGR

Modified Peptide

n[145]QVYASLPGR

Peptide Length

9

ORF Length

149

Open Reading Frame (ORF)

LRAVRPSLFFRRQVYASLPGREDAFHRGIFLFCCHEPPCCAALRVSRNQLPRKNDFYSYEPPSENPSPETGESVYLQLKSGAHLCSVCGCLGPKTCSRCHKAYYCSKEHQTLDWRLGHKQACAQPDHLDLTTPDHNFLFPEFEIVIETR

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0192412

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.831

PhyloCSF Frame 3

0

CNTI Score

-0.322701104