McDonnell Genome Institute

Washington University

Transcript

lnc-PRDM2-2:1

Chromosome

chr1

Gene Name

lnc-PRDM2-2

Start

13696913

CPC Label

noncoding

End

13698781

Cancer

OV

Strand

+

Peptide

NSLQYISPFQR

Modified Peptide

n[145]NSLQYISPFQR

Peptide Length

11

ORF Length

72

Open Reading Frame (ORF)

MMIMSSITVLPQQGTKPARTGTRCTGVEWSLIHVVDLDKEYIFILPSPYRNSLQYISPFQRGKRVIFNISHG

Conservation Score

0.139

PhyloCSF Frame 1

-4.219

No. of Spectra

5

CPC Coding Probability

0.0496666

PhyloCSF Frame 2 

-5.331

CNTI Index

noncoding

Max Probability

0.852

PhyloCSF Frame 3

-5.12

CNTI Score

-0.405322541