McDonnell Genome Institute

Washington University

Transcript

lnc-PRDM14-6:1

Chromosome

chr8

Gene Name

lnc-PRDM14-6

Start

69667048

CPC Label

noncoding

End

69670314

Cancer

OV

Strand

-

Peptide

LLSGCMYFVFGNLK

Modified Peptide

n[145]LLSGCMYFVFGNLK

Peptide Length

14

ORF Length

38

Open Reading Frame (ORF)

LLSGCMYFVFGNLKNFPENKHPLLSFQQLLHLCCKNEA

Conservation Score

1

PhyloCSF Frame 1

-4.342

No. of Spectra

4

CPC Coding Probability

0.0362308

PhyloCSF Frame 2 

-5.471

CNTI Index

noncoding

Max Probability

0.6506

PhyloCSF Frame 3

-4.937

CNTI Score

-0.433309642