McDonnell Genome Institute

Washington University

Transcript

lnc-PRDM11-8:1

Chromosome

chr11

Gene Name

lnc-PRDM11-8

Start

45327972

CPC Label

noncoding

End

45345084

Cancer

CCRC

Strand

+

Peptide

SEPVTPK

Modified Peptide

n[230]SEPVTPK

Peptide Length

7

ORF Length

76

Open Reading Frame (ORF)

LPARKLWNRTRFVGFKNQLSISTKTSPLCFPHTVSLPLWLHFQPRHRQVKLGDQVLLLPRSEPVTPKGPWLPFCSF

Conservation Score

0.177

PhyloCSF Frame 1

-3.483

No. of Spectra

34

CPC Coding Probability

0.0261689

PhyloCSF Frame 2 

-4.091

CNTI Index

noncoding

Max Probability

0.9976

PhyloCSF Frame 3

-4.883

CNTI Score

-0.39800441