McDonnell Genome Institute

Washington University

Transcript

lnc-PRDM1-5:1

Chromosome

chr6

Gene Name

lnc-PRDM1-5

Start

105900281

CPC Label

noncoding

End

105900913

Cancer

BRCA-Luminal B

Strand

+

Peptide

TQAGFVNGTR

Modified Peptide

n[145]TQAGFVNGTR

Peptide Length

10

ORF Length

103

Open Reading Frame (ORF)

LSTHKPELVEKNYYTENRTQAGFVNGTRHGFLTSSLINVLLPPEESVRLLGYSCGQEHTMQQLDLRSVHLSAIETCPRRKTETTQMELPVQILVDVIRLAAFL

Conservation Score

1

PhyloCSF Frame 1

-2.507

No. of Spectra

1

CPC Coding Probability

0.0200384

PhyloCSF Frame 2 

-3.237

CNTI Index

noncoding

Max Probability

0.5157

PhyloCSF Frame 3

-1.86

CNTI Score

-0.418371735