McDonnell Genome Institute

Washington University

Transcript

lnc-PRB2-3:1

Chromosome

chr12

Gene Name

lnc-PRB2-3

Start

11752163

CPC Label

noncoding

End

11752906

Cancer

HCC

Strand

-

Peptide

QGTGTSNFSK

Modified Peptide

n[230]QGTGTSNFSK

Peptide Length

10

ORF Length

52

Open Reading Frame (ORF)

LSTRRFSWLCHILHVSRFLFFLTCHSQGRNEYTEKQGTGTSNFSKVSGGRGV

Conservation Score

0.329

PhyloCSF Frame 1

-3.936

No. of Spectra

3

CPC Coding Probability

0.145728

PhyloCSF Frame 2 

-3.039

CNTI Index

noncoding

Max Probability

0.9986

PhyloCSF Frame 3

-5.106

CNTI Score

-0.388867452