McDonnell Genome Institute

Washington University

Transcript

lnc-PRAG1-6:1

Chromosome

chr8

Gene Name

lnc-PRAG1-6

Start

8292746

CPC Label

noncoding

End

8294834

Cancer

EOGC

Strand

-

Peptide

LHGLPMALGK

Modified Peptide

n[145]LHGLPMALGK

Peptide Length

10

ORF Length

35

Open Reading Frame (ORF)

LHGLPMALGKCHRIIRRVQGKFRARDERGAQKAKE

Conservation Score

0.013

PhyloCSF Frame 1

-3.629

No. of Spectra

19

CPC Coding Probability

0.223545

PhyloCSF Frame 2 

-3.425

CNTI Index

noncoding

Max Probability

1

PhyloCSF Frame 3

-5.527

CNTI Score

-0.363536672